] }); "actions" : [ "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); "revokeMode" : "true", } })(LITHIUM.jQuery); // Pull in global jQuery reference }, "dialogContentCssClass" : "lia-panel-dialog-content", { "actions" : [ ], { "action" : "rerender" "actions" : [ LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); "event" : "RevokeSolutionAction", "action" : "pulsate" "context" : "", // enable redirect to login page when "logmein" is typed into the void =) { LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, "actions" : [ { } LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_d361a5cfad085","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); { Wie soll man da arbeiten und die Kinder am Online-Unterricht teilnehmen?! } { Die Verbindung zeigt aber volle Geschwindigkeit an. "event" : "ProductAnswerComment", } { ] Aber es geht nicht? // Oops, not the right sequence, lets restart from the top. "dialogContentCssClass" : "lia-panel-dialog-content", { { » Vodafone-Kunden haben aktuell mit Problemen zu kämpfen. return; if (doChecks(pagerId, val)) LITHIUM.StarRating('#any_8', false, 1, 'LITHIUM:starRating'); } { } "useTruncatedSubject" : "true", "action" : "rerender" "action" : "addClassName" "truncateBodyRetainsHtml" : "false", } { }, { "actions" : [ "actions" : [ "event" : "AcceptSolutionAction", "context" : "envParam:feedbackData", "action" : "pulsate" "context" : "envParam:selectedMessage", { }, { ] })(LITHIUM.jQuery); lithstudio: [], } "eventActions" : [ ;(function($) { { } { { } "useTruncatedSubject" : "true", Seit heute Morgen gar kein Internet mehr. "context" : "", } "useCountToKudo" : "false", @TwitchDE Da hat Vodafone wohl wieder Probleme mit dem Upload. { "action" : "rerender" }, }, o.innerHTML = ""; }, "action" : "rerender" }, "actions" : [ { "context" : "envParam:feedbackData", } "action" : "rerender" "useCountToKudo" : "false", "eventActions" : [ "initiatorBinding" : true, } { "useTruncatedSubject" : "true", { }, $(this).next().toggle(); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "context" : "", "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" "actions" : [ "context" : "", })(LITHIUM.jQuery); })(LITHIUM.jQuery); "linkDisabled" : "false" "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "disableKudosForAnonUser" : "false", "context" : "envParam:quiltName,message", "context" : "lia-deleted-state", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); "eventActions" : [ { "context" : "", { "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, "event" : "QuickReply", "event" : "MessagesWidgetEditCommentForm", "context" : "envParam:selectedMessage", "context" : "", }); "event" : "expandMessage", } störung über störung. "entity" : "1786904", "event" : "removeMessageUserEmailSubscription", ] // Oops. @vodafone_de ganz erlich labert nicht so groß Vodafone ist das beste und bleibt das beste und wenn es Probleme gibt meldet euch doch einfach auf @vodafoneservice, @Mrluukyy "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "action" : "rerender" } "kudosLinksDisabled" : "false", "actions" : [ "action" : "rerender" "event" : "MessagesWidgetEditAction", function disableInput(pagerId) { ] "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1786914 .lia-rating-control-passive', '#form_4'); }, } ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv/thread-id/284928","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Ivfw1iBtVKNHjKHFi8ednKajPMFNMTqCu5mnnEwZGqc. } @paranoidpeopls "event" : "deleteMessage", }, "action" : "rerender" }, }); { } "context" : "envParam:feedbackData", ] // Reset the conditions so that someone can do it all again. { } LITHIUM.Cache.CustomEvent.set([{"elementId":"link_5","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1785818}},{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1785837}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1786238}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1786556}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1786904}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1786914}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1786989}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1787035}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1787121}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1787675}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2020197}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1729760}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1643707}}]); "dialogContentCssClass" : "lia-panel-dialog-content", "actions" : [ { "action" : "pulsate" Monatlich bezahle ich 39,99 € für Internet bei #Vodafone und immer noch entsteht sehr regelmäßiger Totalausfall... @welt vor corona hatte ich mur probleme mit vodafone aber irgendwie wo jetzt corona ist habe ich null probleme obwohl mehr menschen zuhause sind und internet nutzen,verwirrend ? }); }, ] "action" : "rerender" } ;(function($) { ] })(LITHIUM.jQuery); { LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); }, "actions" : [ "actions" : [ "message" : "1787675", "context" : "", ], { "action" : "rerender" }, ] } "actions" : [ } "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", }, "action" : "addClassName" } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, "actions" : [ } ], LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1786989 .lia-rating-control-passive', '#form_5'); "actions" : [ ] }, ] } { { ] ] ] }, $(document).ready(function(){ "actions" : [ // console.log(key); Execute whatever should happen when entering the right sequence "context" : "", { ] ] "event" : "removeMessageUserEmailSubscription", ] "kudosable" : "true", })(LITHIUM.jQuery); "includeRepliesModerationState" : "false", "actions" : [ ] })(LITHIUM.jQuery); }, "useSubjectIcons" : "true", { { if ( Number(val) < 1 ) function processPageInputBlur(pagerId, val) "action" : "rerender" "event" : "kudoEntity", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); { "disableLabelLinks" : "false", "context" : "", ] "action" : "rerender" "action" : "rerender" }, ', 'ajax'); LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "defaultAriaLabel" : "", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); Preiserhöhung während der Vertragslaufzeit. "}); { "event" : "unapproveMessage", ] "event" : "addMessageUserEmailSubscription", { "context" : "envParam:entity", "context" : "lia-deleted-state", }, "context" : "envParam:quiltName", "actions" : [ }, } } "context" : "", "action" : "rerender" LITHIUM.Loader.runJsAttached(); }, } ] "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, LITHIUM.Dialog.options['652088562'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }); "actions" : [ "action" : "rerender" } { "actions" : [ } }, } "context" : "envParam:quiltName,product,contextId,contextUrl", { "event" : "deleteMessage", { }, "action" : "rerender" ] } }); "event" : "approveMessage", "actions" : [ } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1786556,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); $(document).ready(function(){ "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, })(LITHIUM.jQuery); "revokeMode" : "true", "actions" : [ } { "event" : "ProductAnswer", { })(LITHIUM.jQuery); "actions" : [ "message" : "1786238", "action" : "addClassName" } "disallowZeroCount" : "false", { ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); "event" : "removeMessageUserEmailSubscription", } "disableLinks" : "false", ] "event" : "MessagesWidgetEditCommentForm", } }, "eventActions" : [ }, "actions" : [ "event" : "MessagesWidgetEditAction", "action" : "rerender" "event" : "MessagesWidgetAnswerForm", { } }, @vodafone_de was los mit Festnetz, Tv und Internet? }, }); }); { } "event" : "markAsSpamWithoutRedirect", lithadmin: [] "action" : "rerender" ] "dialogContentCssClass" : "lia-panel-dialog-content", { { } } "context" : "", "}); } "selector" : "#kudosButtonV2_6", "context" : "", { }, }, ;(function($){ LITHIUM.Dialog.options['1706896722'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "kudosLinksDisabled" : "false", .attr('aria-hidden','false') Zudem werden auf der Vodafone-Homepage zahlreiche News und Services rund um das Netz bereitgestellt. "event" : "deleteMessage", { }, "action" : "rerender" "event" : "MessagesWidgetCommentForm", "context" : "", ;(function($) { "context" : "", "truncateBodyRetainsHtml" : "false", { } LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "MessagesWidgetEditAnswerForm", }); "context" : "envParam:entity", "disableLabelLinks" : "false", "context" : "", { } "event" : "removeThreadUserEmailSubscription", "action" : "pulsate" { LITHIUM.AjaxSupport.fromLink('#kudoEntity_7', 'kudoEntity', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {}, '9KGXfCR51UTlCukXR9OMpJZNSDsrEsFxUbkpkRaDboA.